(data stored in ACNUC1104 zone)

EMBL: FN667742.WZZE

FN667742.WZZE        Location/Qualifiers
FT   CDS             319808..320878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0071"
FT                   /gene="wzzE"
FT                   /locus_tag="XNC1_0385"
FT                   /product="modulator of enterobacterial common antigen (ECA)
FT                   polysaccharide chain length"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0385"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88462"
FT                   /db_xref="GOA:D3VHX3"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032895"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHX3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88462.1"
FT                   /translation="MINSETKSKQDQPAIEYELDVRTLCRALWKGKIWIIALAMIFAAV
FT                   ALGASYLMQQKWSATAIVDLPTTNNLGSYYSQQQFLRNLDTHINASPEAQLPTIPDGAY
FT                   KEFMTQVAAYDTRREFWLHSDYYKQRREGGAKADAVLLDELINDIKITRGDDKNAPNDS
FT                   IKLTAETATDSNQLLRKYIAFANQRASEHLNNEIKGAWATRTQSMKALVKRQEMVAKAM
FT                   YTRELNVLQQSSNVAEKQGIHRNQTDIPIEELPESKMFMLGTSLLQAQIETLEATGPDY
FT                   SIDYDQNIAMLATLNVGPTLQDTFQTYRYLRTPEEPVGRDSPRRIFMMVMWGAVGMLMG
FT                   AGLALVRRHRYSNPEQ"
     MINSETKSKQ DQPAIEYELD VRTLCRALWK GKIWIIALAM IFAAVALGAS YLMQQKWSAT        60
     AIVDLPTTNN LGSYYSQQQF LRNLDTHINA SPEAQLPTIP DGAYKEFMTQ VAAYDTRREF       120
     WLHSDYYKQR REGGAKADAV LLDELINDIK ITRGDDKNAP NDSIKLTAET ATDSNQLLRK       180
     YIAFANQRAS EHLNNEIKGA WATRTQSMKA LVKRQEMVAK AMYTRELNVL QQSSNVAEKQ       240
     GIHRNQTDIP IEELPESKMF MLGTSLLQAQ IETLEATGPD YSIDYDQNIA MLATLNVGPT       300
     LQDTFQTYRY LRTPEEPVGR DSPRRIFMMV MWGAVGMLMG AGLALVRRHR YSNPEQ           356
//

If you have problems or comments...

PBIL Back to PBIL home page