(data stored in ACNUC1104 zone)

EMBL: FN667742.YBGL

FN667742.YBGL        Location/Qualifiers
FT   CDS             542853..543620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0118"
FT                   /gene="ybgL"
FT                   /locus_tag="XNC1_0631"
FT                   /product="putative lactam utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0631"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88702"
FT                   /db_xref="GOA:D3VJE6"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJE6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88702.1"
FT                   /translation="MIKTIDLNSDLGEGFGQWRMGNDKAMLEIVSSANIACGFHAGDPA
FT                   GILQTLNSAKKNNVVIGAHVSYPDLVGFGRRKMDIASHELTADVIYQIAALQGLAKTVN
FT                   TKVSYIKPHGALYNTIANDEYQAMAVIDGILAIDPCLTLVGLAGSNILRLAQEKGLKTI
FT                   AEAFADRAYTSKGELVSRRESGSVLHNADLVARRMLQLVTEGGVESIDGKFTPIQADSI
FT                   CVHGDSPGSVEMAREVKTVLEQSGITIRSFICP"
     MIKTIDLNSD LGEGFGQWRM GNDKAMLEIV SSANIACGFH AGDPAGILQT LNSAKKNNVV        60
     IGAHVSYPDL VGFGRRKMDI ASHELTADVI YQIAALQGLA KTVNTKVSYI KPHGALYNTI       120
     ANDEYQAMAV IDGILAIDPC LTLVGLAGSN ILRLAQEKGL KTIAEAFADR AYTSKGELVS       180
     RRESGSVLHN ADLVARRMLQ LVTEGGVESI DGKFTPIQAD SICVHGDSPG SVEMAREVKT       240
     VLEQSGITIR SFICP                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page