(data stored in ACNUC1104 zone)

EMBL: FN667742.YDCQ

FN667742.YDCQ        Location/Qualifiers
FT   CDS             complement(101830..102246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcQ"
FT                   /locus_tag="XNC1_0105"
FT                   /product="putative regulator with DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0105"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88193"
FT                   /db_xref="GOA:D3VGA3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGA3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88193.1"
FT                   /translation="MRYPVTLEPVEEGGYFVSFPDIPEALTQGETREEALEMALDALIT
FT                   SFEFYFEDNEKIPLPSPIGQDDDYVDVPLSITSKVLMLNAFIDSKLTQTELASRMGVKK
FT                   QEVTRIFDLRHSTKIDTVGKAAAVIGHQLTLSMQ"
     MRYPVTLEPV EEGGYFVSFP DIPEALTQGE TREEALEMAL DALITSFEFY FEDNEKIPLP        60
     SPIGQDDDYV DVPLSITSKV LMLNAFIDSK LTQTELASRM GVKKQEVTRI FDLRHSTKID       120
     TVGKAAAVIG HQLTLSMQ                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page