(data stored in ACNUC1104 zone)

EMBL: FN667742.YDFJ

FN667742.YDFJ        Location/Qualifiers
FT   CDS             357490..358887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0079"
FT                   /gene="ydfJ"
FT                   /locus_tag="XNC1_0427"
FT                   /product="putative transport protein (MFS family)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0427"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88504"
FT                   /db_xref="GOA:D3VI15"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI15"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88504.1"
FT                   /translation="MPYKNTALAVAQRQHASEAYLTTKEGRKGFWRAIFSCWLGTTIEY
FT                   ADFALYGLAAGIIFGDVFFPEMTPAVALFASFATYSVGFIARPIGALVFGWLGDRKGRK
FT                   IVMIMTVILMSVSTTLIGLIPSYAHIGAWAPACLVMLRFIQGLGAGAALSGGTVILGEF
FT                   APPARRGLVSSAIALGSNSGTLLASLVWLLVLTMDKESLLDWGWRIPFLSSAIIAIVAL
FT                   YIRRYMSETPVFERYKEMLAEQRLQALTENEKRHTDDERRSFWQRTKAFWIMMGLRIGE
FT                   NGPSYLAQGFMIGYVANVLMLDKFTPTIAVFIASILGFLIIPLAGYLSDRFGRRIIYRW
FT                   FCLLLILYAFPAFILLDSREPMIVIPTIVIGMGLASLGIFGAQAAWGVELFGVANRYTK
FT                   MALAKELGAVLSGGTAPLIASALFSFAGHWWPIACYFALMASIGFITTFFAPETRGRDL
FT                   NLLEDAI"
     MPYKNTALAV AQRQHASEAY LTTKEGRKGF WRAIFSCWLG TTIEYADFAL YGLAAGIIFG        60
     DVFFPEMTPA VALFASFATY SVGFIARPIG ALVFGWLGDR KGRKIVMIMT VILMSVSTTL       120
     IGLIPSYAHI GAWAPACLVM LRFIQGLGAG AALSGGTVIL GEFAPPARRG LVSSAIALGS       180
     NSGTLLASLV WLLVLTMDKE SLLDWGWRIP FLSSAIIAIV ALYIRRYMSE TPVFERYKEM       240
     LAEQRLQALT ENEKRHTDDE RRSFWQRTKA FWIMMGLRIG ENGPSYLAQG FMIGYVANVL       300
     MLDKFTPTIA VFIASILGFL IIPLAGYLSD RFGRRIIYRW FCLLLILYAF PAFILLDSRE       360
     PMIVIPTIVI GMGLASLGIF GAQAAWGVEL FGVANRYTKM ALAKELGAVL SGGTAPLIAS       420
     ALFSFAGHWW PIACYFALMA SIGFITTFFA PETRGRDLNL LEDAI                       465
//

If you have problems or comments...

PBIL Back to PBIL home page