(data stored in ACNUC1104 zone)

EMBL: FN667742.YECS

FN667742.YECS        Location/Qualifiers
FT   CDS             complement(491343..492059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0107"
FT                   /gene="yecS"
FT                   /locus_tag="XNC1_0572"
FT                   /product="putative amino acid transport protein (ABC
FT                   superfamily, membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0572"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88646"
FT                   /db_xref="GOA:D3VIU6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIU6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88646.1"
FT                   /translation="MTPSWLSLALDSLWPMLYAGLTFTIPLTLITFALGISLGFIVALI
FT                   RLYGPKPLIAVVRFYVWLIRGTPLLVQLFLIFYALPSVGITLEAFTSAVIGFTLNVGAY
FT                   TSEVIRAALISVPKGQWEASHSIGMSWWQSLRRIVLPQAARFSIPPLSNTFISLVKDTS
FT                   LASVITVPEMFLAAQRIAAVTYQPLILYTEAAILYLLLSSVLSALQVRLEKKFAQQNSH
FT                   QQSSNKEAKDDSAHQH"
     MTPSWLSLAL DSLWPMLYAG LTFTIPLTLI TFALGISLGF IVALIRLYGP KPLIAVVRFY        60
     VWLIRGTPLL VQLFLIFYAL PSVGITLEAF TSAVIGFTLN VGAYTSEVIR AALISVPKGQ       120
     WEASHSIGMS WWQSLRRIVL PQAARFSIPP LSNTFISLVK DTSLASVITV PEMFLAAQRI       180
     AAVTYQPLIL YTEAAILYLL LSSVLSALQV RLEKKFAQQN SHQQSSNKEA KDDSAHQH         238
//

If you have problems or comments...

PBIL Back to PBIL home page