(data stored in ACNUC1104 zone)

EMBL: FN667742.YHHF

FN667742.YHHF        Location/Qualifiers
FT   CDS             complement(573884..574474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0122"
FT                   /gene="yhhF"
FT                   /locus_tag="XNC1_0661"
FT                   /product="putative methyltransferase with SAM-dependent
FT                   methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0661"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88732"
FT                   /db_xref="GOA:D3VJH6"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJH6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88732.1"
FT                   /translation="MTKKPQRASLGQIRIIGGKWRGRKLPVPDSDGLRPTTDRVRETLF
FT                   NWLMPIIQEARCLDCFSGSGALGFEALSRYASHATLIEYDRNVAKQLSANLALLNAENA
FT                   DVVQENALQYLNNPGTPFDVVFLDPPFRKGMLTETIHLLENNGWLAEESWIYVEAESES
FT                   AATQVPAHWQLHREKIAGQVAYRLYIRHQESAV"
     MTKKPQRASL GQIRIIGGKW RGRKLPVPDS DGLRPTTDRV RETLFNWLMP IIQEARCLDC        60
     FSGSGALGFE ALSRYASHAT LIEYDRNVAK QLSANLALLN AENADVVQEN ALQYLNNPGT       120
     PFDVVFLDPP FRKGMLTETI HLLENNGWLA EESWIYVEAE SESAATQVPA HWQLHREKIA       180
     GQVAYRLYIR HQESAV                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page