(data stored in ACNUC1104 zone)

EMBL: FN667742.YHHQ

FN667742.YHHQ        Location/Qualifiers
FT   CDS             complement(568758..569423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhhQ"
FT                   /locus_tag="XNC1_0655"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0655"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88726"
FT                   /db_xref="GOA:D3VJH0"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJH0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88726.1"
FT                   /translation="MFQLTPQQRITALIWLSLFHILIITSSNYLVQLPISIFGFHTTWG
FT                   AFTFPFIFLATDLTVRIYGAPLARRIIISVMLPALLISYLISALFFQGTWQGFEALGTF
FT                   NLFVARIAAASFMAYVLGQILDVSVFNRLRRQSRWWIAPATAMFFGNMLDTLAFFFIAF
FT                   YRSTDAFMATHWVEIALVDYAFKLFICMLFFLPAYGFMLNLIIKYFFSGTEKNILPQA"
     MFQLTPQQRI TALIWLSLFH ILIITSSNYL VQLPISIFGF HTTWGAFTFP FIFLATDLTV        60
     RIYGAPLARR IIISVMLPAL LISYLISALF FQGTWQGFEA LGTFNLFVAR IAAASFMAYV       120
     LGQILDVSVF NRLRRQSRWW IAPATAMFFG NMLDTLAFFF IAFYRSTDAF MATHWVEIAL       180
     VDYAFKLFIC MLFFLPAYGF MLNLIIKYFF SGTEKNILPQ A                           221
//

If you have problems or comments...

PBIL Back to PBIL home page