(data stored in ACNUC1104 zone)

EMBL: FN667742.YIFB

FN667742.YIFB        Location/Qualifiers
FT   CDS             complement(297047..298573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yifB"
FT                   /locus_tag="XNC1_0366"
FT                   /product="putative enzyme (N-terminal); transcriptional
FT                   regulator with P-loop containing NTP hydrolase domain
FT                   (C-terminal)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0366"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88443"
FT                   /db_xref="GOA:D3VHV4"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHV4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88443.1"
FT                   /translation="MALSVIRTRATIGIDSPLVTIEAHISNGLPGLTLVGLPETTVKEA
FT                   RDRVRSALLNSGFTYPPKRITVNLAPADLPKEGGRYDLPIAIAVLAASKQISTDKLQNY
FT                   EFLGELALSGEIRRVMGAIPAALSAKGAGRQLILSSENSVELAILPSDEALMAEHLLQV
FT                   CHFLEGKNTSLSPPLPIKLQTEPSILDMQDIIGQEQAKRALEITAAGGHNLLLLGPPGT
FT                   GKTMLASRLCSLLPPLTHQEALEVASINSLVGYSMNPQKWHTRPFRAPHHSSSMAALVG
FT                   GGSIPRPGEISLAHNGVLFLDELPEFNRSVLDALREPLESGEIVISRAKAKVCFPAQVQ
FT                   LIAAMNPSPTGYHQGLHNRSSPQQVLRYLSKLSGPFLDRFDLSIEVPLLPPGILSQSSA
FT                   KHGESSHDVKKRVQTARKIQIERCGCINAVLNSKQTEDICQLKIEDAVFLENTLLKLGL
FT                   SIRAWHRILKVSRTIADLKEQKRIEKPDIMEALSYRSMDRLLIQLQKQAG"
     MALSVIRTRA TIGIDSPLVT IEAHISNGLP GLTLVGLPET TVKEARDRVR SALLNSGFTY        60
     PPKRITVNLA PADLPKEGGR YDLPIAIAVL AASKQISTDK LQNYEFLGEL ALSGEIRRVM       120
     GAIPAALSAK GAGRQLILSS ENSVELAILP SDEALMAEHL LQVCHFLEGK NTSLSPPLPI       180
     KLQTEPSILD MQDIIGQEQA KRALEITAAG GHNLLLLGPP GTGKTMLASR LCSLLPPLTH       240
     QEALEVASIN SLVGYSMNPQ KWHTRPFRAP HHSSSMAALV GGGSIPRPGE ISLAHNGVLF       300
     LDELPEFNRS VLDALREPLE SGEIVISRAK AKVCFPAQVQ LIAAMNPSPT GYHQGLHNRS       360
     SPQQVLRYLS KLSGPFLDRF DLSIEVPLLP PGILSQSSAK HGESSHDVKK RVQTARKIQI       420
     ERCGCINAVL NSKQTEDICQ LKIEDAVFLE NTLLKLGLSI RAWHRILKVS RTIADLKEQK       480
     RIEKPDIMEA LSYRSMDRLL IQLQKQAG                                          508
//

If you have problems or comments...

PBIL Back to PBIL home page