(data stored in ACNUC1104 zone)

EMBL: FN667742.YIGB

FN667742.YIGB        Location/Qualifiers
FT   CDS             345287..346003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0076"
FT                   /gene="yigB"
FT                   /locus_tag="XNC1_0412"
FT                   /product="putative enzyme with a phosphatase-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0412"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88489"
FT                   /db_xref="GOA:D3VI00"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI00"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88489.1"
FT                   /translation="MRFYRPLAPFAAMTFDLDDTLYDNHPVIDKTEKEVLCFIRQYNTK
FT                   FRYFERKDLHLYRQAVLEQAPDIYHDITLWRQQSVELMFRHHGFNHEETICGTDEIMAC
FT                   FMYWRNQIIVPESTHDTLSTLAKKIPLVAITNGNAEPAACGLSPYFTFVLKAGVNGRSK
FT                   PCPDMYYLAAERLNLPINQILHVGDSLKTDVEGALCSGMQACWINLENKNLMQESEGRL
FT                   VPHVEISDLASLIALI"
     MRFYRPLAPF AAMTFDLDDT LYDNHPVIDK TEKEVLCFIR QYNTKFRYFE RKDLHLYRQA        60
     VLEQAPDIYH DITLWRQQSV ELMFRHHGFN HEETICGTDE IMACFMYWRN QIIVPESTHD       120
     TLSTLAKKIP LVAITNGNAE PAACGLSPYF TFVLKAGVNG RSKPCPDMYY LAAERLNLPI       180
     NQILHVGDSL KTDVEGALCS GMQACWINLE NKNLMQESEG RLVPHVEISD LASLIALI         238
//

If you have problems or comments...

PBIL Back to PBIL home page