(data stored in ACNUC1104 zone)

EMBL: FN667742.YIIP

FN667742.YIIP        Location/Qualifiers
FT   CDS             complement(99600..100499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yiiP"
FT                   /locus_tag="XNC1_0101"
FT                   /product="putative transport protein (CDF family)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0101"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88189"
FT                   /db_xref="GOA:D3VG99"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG99"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88189.1"
FT                   /translation="MSINYGRWISTAALAATVLASVLLIVKIFSWWLTGSVSLLAALVD
FT                   SLVDLAASLTNFFAVRYSLQPADKEHTFGHGKAESLAALAQSMFISGSAIFLFLTGLQH
FT                   LLSPKPLEHAVIGIWVIIIALISTLCLVTFQKWVLNKTQSQAIRADMLHYKSDLLMNGA
FT                   ILVALILSVYGFKRADALFALGIGCYILYSALRMGYDAVQSLLDRALPDEERQEIIEII
FT                   RNYPGISGGHDLKTRQSGPTRFIQFHLEMDDHLPLVQAHALAEGIENKLRNRFPGADII
FT                   IHQDPCSVIPEEHKNRWD"
     MSINYGRWIS TAALAATVLA SVLLIVKIFS WWLTGSVSLL AALVDSLVDL AASLTNFFAV        60
     RYSLQPADKE HTFGHGKAES LAALAQSMFI SGSAIFLFLT GLQHLLSPKP LEHAVIGIWV       120
     IIIALISTLC LVTFQKWVLN KTQSQAIRAD MLHYKSDLLM NGAILVALIL SVYGFKRADA       180
     LFALGIGCYI LYSALRMGYD AVQSLLDRAL PDEERQEIIE IIRNYPGISG GHDLKTRQSG       240
     PTRFIQFHLE MDDHLPLVQA HALAEGIENK LRNRFPGADI IIHQDPCSVI PEEHKNRWD        299
//

If you have problems or comments...

PBIL Back to PBIL home page