(data stored in ACNUC1104 zone)

EMBL: FN667742.YJCG

FN667742.YJCG        Location/Qualifiers
FT   CDS             complement(53574..55229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0009"
FT                   /gene="yjcG"
FT                   /locus_tag="XNC1_0050"
FT                   /product="putative transporter of the sodium symport
FT                   superfamily (SSS family); putative transmembrane protein"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0050"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88138"
FT                   /db_xref="GOA:D3VG48"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR014083"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG48"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88138.1"
FT                   /translation="MKKIVLPTIPLCFSLLAQADAISGNNVEKQPLNIQAIVMFLLFVG
FT                   LTLCITYWASKRTISRSDYYTAGGRITGFQNGMAIAGDYMSAASFLGISALVYTSGYDG
FT                   LIYSIGFLVGWPIILFLIAERLRNLGRYTFADVASYRLKQSPIRTLSAIGSLVVVALYL
FT                   IAQMVGAGKLIELLFGLNYYIAVVLVGILMVLYVLFGGMLATTWVQIIKAILLLAGATF
FT                   MAVMVMKAVNFNFNTLFKEAIAVHTLGPAIMSPGGLVSDPISALSLGLALMFGTAGLPH
FT                   IIMRFFTVNDAKEARKSVFYATGFIGYFYILTFIIGFGAILLVSANPSFKDATGTLIGG
FT                   TNMAAVHLASAVGGDFFLGFISAVAFATILAVVAGLTLAGASAVSHDLYANVIKKGQAN
FT                   ERDELRVSKITVVILGIVAIGLGILFEKQNIAFMVGLAFSIAASCNFPIILLSMYWHKL
FT                   TTRGALIGGGLGLLTAVVLMILGPTIWVSILGHEKPIYPYEYPALFSMSVAFIGAWLFS
FT                   ITDTSIQGQQEREKFRSQFIRSQTGIGIEQGKAH"
     MKKIVLPTIP LCFSLLAQAD AISGNNVEKQ PLNIQAIVMF LLFVGLTLCI TYWASKRTIS        60
     RSDYYTAGGR ITGFQNGMAI AGDYMSAASF LGISALVYTS GYDGLIYSIG FLVGWPIILF       120
     LIAERLRNLG RYTFADVASY RLKQSPIRTL SAIGSLVVVA LYLIAQMVGA GKLIELLFGL       180
     NYYIAVVLVG ILMVLYVLFG GMLATTWVQI IKAILLLAGA TFMAVMVMKA VNFNFNTLFK       240
     EAIAVHTLGP AIMSPGGLVS DPISALSLGL ALMFGTAGLP HIIMRFFTVN DAKEARKSVF       300
     YATGFIGYFY ILTFIIGFGA ILLVSANPSF KDATGTLIGG TNMAAVHLAS AVGGDFFLGF       360
     ISAVAFATIL AVVAGLTLAG ASAVSHDLYA NVIKKGQANE RDELRVSKIT VVILGIVAIG       420
     LGILFEKQNI AFMVGLAFSI AASCNFPIIL LSMYWHKLTT RGALIGGGLG LLTAVVLMIL       480
     GPTIWVSILG HEKPIYPYEY PALFSMSVAF IGAWLFSITD TSIQGQQERE KFRSQFIRSQ       540
     TGIGIEQGKA H                                                            551
//

If you have problems or comments...

PBIL Back to PBIL home page