(data stored in ACNUC1104 zone)

EMBL: FN667742.YRDA

FN667742.YRDA        Location/Qualifiers
FT   CDS             complement(289255..289812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrdA"
FT                   /locus_tag="XNC1_0356"
FT                   /product="putative acyl transferase with trimeric LpxA-like
FT                   domain , ferripyochelin-binding"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0356"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88438"
FT                   /db_xref="GOA:D3VHU9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHU9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88438.1"
FT                   /translation="MSTVLRQYLDLYPQVGRKVFLDSSSVVIGDVRLAEDISIWPLVVI
FT                   RGDVNYVSIGSRTNIQDGSVLHVTHKSRDNPNGFPLIIGEDVTVGHKAILHGCTVGNRV
FT                   LVGMGSILLDGVIVEDDVIIGAGSLVPPRKKLESGYLYVGSPAKQVRKLKPEELEGLLY
FT                   SANNYARWKDDYLLAEQSEGKE"
     MSTVLRQYLD LYPQVGRKVF LDSSSVVIGD VRLAEDISIW PLVVIRGDVN YVSIGSRTNI        60
     QDGSVLHVTH KSRDNPNGFP LIIGEDVTVG HKAILHGCTV GNRVLVGMGS ILLDGVIVED       120
     DVIIGAGSLV PPRKKLESGY LYVGSPAKQV RKLKPEELEG LLYSANNYAR WKDDYLLAEQ       180
     SEGKE                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page