(data stored in ACNUC1104 zone)

EMBL: FN667742.YRDC

FN667742.YRDC        Location/Qualifiers
FT   CDS             287628..288197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0067"
FT                   /gene="yrdC"
FT                   /locus_tag="XNC1_0353"
FT                   /product="putative RNA-binding protein with unique protein
FT                   fold, with YrdC/RibB domain"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0353"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88435"
FT                   /db_xref="GOA:D3VHU6"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHU6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88435.1"
FT                   /translation="MSNEISPAFDSIVTALKEGKVIAYPTEAVFGLGCDPDSENAVQEL
FT                   LALKNRPWEKGLILIADNYERLCSYIDDVQLSDEQKETIFSFWPGPVTWVIPAKKITPK
FT                   WLTGKFSTLAVRVTDHPLVKQLCSLYGKPLVSTSANLSGLEPCRSVEEVRLQFGNRIPV
FT                   LSGEVGGRKNPSEIRDALTGKLYRQG"
     MSNEISPAFD SIVTALKEGK VIAYPTEAVF GLGCDPDSEN AVQELLALKN RPWEKGLILI        60
     ADNYERLCSY IDDVQLSDEQ KETIFSFWPG PVTWVIPAKK ITPKWLTGKF STLAVRVTDH       120
     PLVKQLCSLY GKPLVSTSAN LSGLEPCRSV EEVRLQFGNR IPVLSGEVGG RKNPSEIRDA       180
     LTGKLYRQG                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page