(data stored in ACNUC7421 zone)

EMBL: FN667743.PE11

FN667743.PE11        Location/Qualifiers
FT   CDS             complement(7335..7970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0011"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0011"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92879"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLS7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92879.1"
FT                   /translation="MMRNDTMRQLIAILGVAILAGCASNAPEQKPQSQISPAENDKPAR
FT                   VNRELSIAWDNMGRGGAALRQPGYIHVLGDGNVSATINKAKDNSTDAVKTPVGIKQQGD
FT                   VGEAINTFKSMNKGKGYSLYELSRWERYCDSGKGMDEHDWRFIEGEGATNIPQDVVTGC
FT                   IPPTHNYQDYLNAWTHFCTSQAVTDADRRIVRESVRPYSVVNPCKALK"
     MMRNDTMRQL IAILGVAILA GCASNAPEQK PQSQISPAEN DKPARVNREL SIAWDNMGRG        60
     GAALRQPGYI HVLGDGNVSA TINKAKDNST DAVKTPVGIK QQGDVGEAIN TFKSMNKGKG       120
     YSLYELSRWE RYCDSGKGMD EHDWRFIEGE GATNIPQDVV TGCIPPTHNY QDYLNAWTHF       180
     CTSQAVTDAD RRIVRESVRP YSVVNPCKAL K                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page