(data stored in ACNUC7421 zone)

EMBL: FN667743.PE120

FN667743.PE120       Location/Qualifiers
FT   CDS             109104..109856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0120"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0120"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92988"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM36"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92988.1"
FT                   /translation="MGTSQSSTGPGGGSPLVPPWADDQPQQPLPPPQERRFAPFRESLG
FT                   NAVLNGNRADFRKAIGHYARKASGGSGSAARRLGSVTQAGGGLFGALAGMPAAPGEPSI
FT                   DLGSLAGLPCEMAISAIAQALTSQDGDSEKICAAMNHALVEALDGVAIFDPQKITDGVI
FT                   VDTMICYLAESIFLQMVMDSNKAWNKADTPSKAIHAETELRELIKVVVDKHMAPKLVGN
FT                   IRTFSKNQMINIERQVIIEAWQEWEAYQ"
     MGTSQSSTGP GGGSPLVPPW ADDQPQQPLP PPQERRFAPF RESLGNAVLN GNRADFRKAI        60
     GHYARKASGG SGSAARRLGS VTQAGGGLFG ALAGMPAAPG EPSIDLGSLA GLPCEMAISA       120
     IAQALTSQDG DSEKICAAMN HALVEALDGV AIFDPQKITD GVIVDTMICY LAESIFLQMV       180
     MDSNKAWNKA DTPSKAIHAE TELRELIKVV VDKHMAPKLV GNIRTFSKNQ MINIERQVII       240
     EAWQEWEAYQ                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page