(data stored in ACNUC7421 zone)

EMBL: FN667743.PE122

FN667743.PE122       Location/Qualifiers
FT   CDS             111154..111879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0122"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92990"
FT                   /db_xref="GOA:D3VM38"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM38"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92990.1"
FT                   /translation="MSIDMHCHLDLYSQPEQVAEECKRRGTYILSVTTTPRAWHGTSSL
FT                   AKGSQRIRTALGLHPQIAHQRSHELELFDSLLSETRYIGEIGLDGGKGFKEHWDIQLKV
FT                   FRHILNNVNRAGGKIMTIHSRGSASVVLDEIENIDGVAVLHWFTGTPKQLERAIDLGCW
FT                   FSVGPAMLDTIKGKSLALKIPKSRILTETDGPFGKFRNDPLMPWDSEIAEKQLTTLWDM
FT                   SQMEVKAQLFENFRELCKL"
     MSIDMHCHLD LYSQPEQVAE ECKRRGTYIL SVTTTPRAWH GTSSLAKGSQ RIRTALGLHP        60
     QIAHQRSHEL ELFDSLLSET RYIGEIGLDG GKGFKEHWDI QLKVFRHILN NVNRAGGKIM       120
     TIHSRGSASV VLDEIENIDG VAVLHWFTGT PKQLERAIDL GCWFSVGPAM LDTIKGKSLA       180
     LKIPKSRILT ETDGPFGKFR NDPLMPWDSE IAEKQLTTLW DMSQMEVKAQ LFENFRELCK       240
     L                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page