(data stored in ACNUC7421 zone)

EMBL: FN667743.PE123

FN667743.PE123       Location/Qualifiers
FT   CDS             complement(111905..112228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0123"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0123"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92991"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM39"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92991.1"
FT                   /translation="MFAMLKMQNSNSFFSLIVAIASAHVKQRPLSFSDNSTYDTNTNLY
FT                   TGHDITSNKAAVNEFVKTGLAVLKIDEFGNAGLELVARPVFLSDFGVVSRKPPKFCQRG
FT                   VPA"
     MFAMLKMQNS NSFFSLIVAI ASAHVKQRPL SFSDNSTYDT NTNLYTGHDI TSNKAAVNEF        60
     VKTGLAVLKI DEFGNAGLEL VARPVFLSDF GVVSRKPPKF CQRGVPA                     107
//

If you have problems or comments...

PBIL Back to PBIL home page