(data stored in ACNUC7421 zone)

EMBL: FN667743.PE138

FN667743.PE138       Location/Qualifiers
FT   CDS             complement(123340..123741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0138"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0138"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93006"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM54"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93006.1"
FT                   /translation="MSQQDFIIWVFCWVDDNLTQLQQGVRFRSRGLPPKLSDAEVITME
FT                   VIGEFLGFSTDKGIWTYFCHHWRDWFPGLGSRANFAKQAANLWVVKQKLQEKLAILLGA
FT                   FDRPVHIIDGFPLPVCGFKRAKGCANFKG"
     MSQQDFIIWV FCWVDDNLTQ LQQGVRFRSR GLPPKLSDAE VITMEVIGEF LGFSTDKGIW        60
     TYFCHHWRDW FPGLGSRANF AKQAANLWVV KQKLQEKLAI LLGAFDRPVH IIDGFPLPVC       120
     GFKRAKGCAN FKG                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page