(data stored in ACNUC7421 zone)

EMBL: FN667743.PE147

FN667743.PE147       Location/Qualifiers
FT   CDS             129745..130785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0147"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0147"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93015"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM63"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93015.1"
FT                   /translation="MARKLVEYDDVAAAAQRLKDAGKRPTLIAVRDLIGKGSYTTISTF
FT                   LKQWSEEHSLDDEPVEVILPESVMSDAQLFLQKIYTVAKASADDQLERERELLRQKEIE
FT                   FQEDMQQAVDMANDATEKSELLEEQLEAITNKKAESDAALAKTESSLSLKSAELERSLT
FT                   DIEKLEKRIMDLEGKLEAKSTELTRAQDHLEQAESENLSLSQKLATTEGELSAQKGKSI
FT                   EQTEKLRAAHEQNKALKEQLENTQAKLAQSQDSLATAKAHGESLERECQRLSGDVQKLE
FT                   SKLSSAEAEARSLVQDKGVIAGQLQEKDQQTKNLELRLNEALTKISGLELELVKTGKGG
FT                   KKKEEN"
     MARKLVEYDD VAAAAQRLKD AGKRPTLIAV RDLIGKGSYT TISTFLKQWS EEHSLDDEPV        60
     EVILPESVMS DAQLFLQKIY TVAKASADDQ LERERELLRQ KEIEFQEDMQ QAVDMANDAT       120
     EKSELLEEQL EAITNKKAES DAALAKTESS LSLKSAELER SLTDIEKLEK RIMDLEGKLE       180
     AKSTELTRAQ DHLEQAESEN LSLSQKLATT EGELSAQKGK SIEQTEKLRA AHEQNKALKE       240
     QLENTQAKLA QSQDSLATAK AHGESLEREC QRLSGDVQKL ESKLSSAEAE ARSLVQDKGV       300
     IAGQLQEKDQ QTKNLELRLN EALTKISGLE LELVKTGKGG KKKEEN                      346
//

If you have problems or comments...

PBIL Back to PBIL home page