(data stored in ACNUC7421 zone)

EMBL: FN667743.PE153

FN667743.PE153       Location/Qualifiers
FT   CDS             complement(133976..134395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0153"
FT                   /product="putative transcriptional regulator, DNA-binding
FT                   protein HLP-II (HU, BH2, HD, NS), increases DNA thermal
FT                   stability"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0153"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93021"
FT                   /db_xref="GOA:D3VM69"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR027454"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM69"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93021.1"
FT                   /translation="MKDHEEFSTLSAAERRELIIAELKRKSRIRTLLRGLPLDEVREII
FT                   DRMKGVLNELEEEYKKREEEEKEKRAQAERIMSDMESCGVDINLLNEMYTSKSEPDNAK
FT                   YSKDGVSWSGQGRRPDAFKGLGHVELERFRIPQKK"
     MKDHEEFSTL SAAERRELII AELKRKSRIR TLLRGLPLDE VREIIDRMKG VLNELEEEYK        60
     KREEEEKEKR AQAERIMSDM ESCGVDINLL NEMYTSKSEP DNAKYSKDGV SWSGQGRRPD       120
     AFKGLGHVEL ERFRIPQKK                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page