(data stored in ACNUC7421 zone)

EMBL: FN667743.PE16

FN667743.PE16        Location/Qualifiers
FT   CDS             11603..12382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0016"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0016"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92884"
FT                   /db_xref="GOA:D3VLT2"
FT                   /db_xref="InterPro:IPR019476"
FT                   /db_xref="InterPro:IPR022266"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLT2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92884.1"
FT                   /translation="MIMDSSPLIKVGNSLLFKLKCQIWSELIHLKHTEGHTLIVGTTGS
FT                   GKTRMFDILISQAILRGEAVIIIDPKGDKEMRDNARRACEAMGQPERFVSFHPAFPEES
FT                   VRIDPLRNFTRVTEIASRLAALIPSEEERQKSKGMQDMGKGWFAWVKGRMEAFVNVIYQ
FT                   FYTRLALLAAWAPYMLILFVPAVYDGMMTWRIKRTNFDYASPVLHRYSVRGTMYLMAGL
FT                   FIAFFIPIALDPVVIPLTMMTCCVLVGLTFGNLQKRV"
     MIMDSSPLIK VGNSLLFKLK CQIWSELIHL KHTEGHTLIV GTTGSGKTRM FDILISQAIL        60
     RGEAVIIIDP KGDKEMRDNA RRACEAMGQP ERFVSFHPAF PEESVRIDPL RNFTRVTEIA       120
     SRLAALIPSE EERQKSKGMQ DMGKGWFAWV KGRMEAFVNV IYQFYTRLAL LAAWAPYMLI       180
     LFVPAVYDGM MTWRIKRTNF DYASPVLHRY SVRGTMYLMA GLFIAFFIPI ALDPVVIPLT       240
     MMTCCVLVGL TFGNLQKRV                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page