(data stored in ACNUC7421 zone)

EMBL: FN667743.PE168

FN667743.PE168       Location/Qualifiers
FT   CDS             143300..143683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0168"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0168"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93036"
FT                   /db_xref="GOA:D3VM84"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM84"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93036.1"
FT                   /translation="MKRQQRLCWPLTSKCMRNFSENLMLHEENVMEKIKNVDAVEFTVE
FT                   DKKAMTHAAYAQCIFILAQALAFPSLGMAGAMVAALCGMMPWLTKFAKEAPSKAFGMVM
FT                   ASLCIAPVYGKLCELVIHAIQGA"
     MKRQQRLCWP LTSKCMRNFS ENLMLHEENV MEKIKNVDAV EFTVEDKKAM THAAYAQCIF        60
     ILAQALAFPS LGMAGAMVAA LCGMMPWLTK FAKEAPSKAF GMVMASLCIA PVYGKLCELV       120
     IHAIQGA                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page