(data stored in ACNUC7421 zone)

EMBL: FN667743.PE176

FN667743.PE176       Location/Qualifiers
FT   CDS             147947..148945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0176"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0176"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93044"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM92"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93044.1"
FT                   /translation="MFDAFGDAQEVTREMLLEQAELIHTISDKCQSTGLFLDSQARFNQ
FT                   FVQEIEADDKVEDRLLHAWCWVIDRIVKAPTSFHMDGAVILTMPLVAKYLPPVEREPET
FT                   IVVNLDEDYKAPVGNQTLCELIMERRHWPQGATCATQEADGGVLYWDAPVDVVEEGRKV
FT                   AGKHGMMAEVGLKHQVDAWYADMDDIRLATDWNSSVITPHCLLLAYLDVLQKNKVPFDE
FT                   GVRLAAEWVTQLGGESREDTEEEPEAEATVLSLGRATAHCFKPYRRNNMRYQVFKTKEG
FT                   GQPVFTAPWYWLASTIANWSSLKWDVCRIVDSKVNETRFCWAKALPAEKNN"
     MFDAFGDAQE VTREMLLEQA ELIHTISDKC QSTGLFLDSQ ARFNQFVQEI EADDKVEDRL        60
     LHAWCWVIDR IVKAPTSFHM DGAVILTMPL VAKYLPPVER EPETIVVNLD EDYKAPVGNQ       120
     TLCELIMERR HWPQGATCAT QEADGGVLYW DAPVDVVEEG RKVAGKHGMM AEVGLKHQVD       180
     AWYADMDDIR LATDWNSSVI TPHCLLLAYL DVLQKNKVPF DEGVRLAAEW VTQLGGESRE       240
     DTEEEPEAEA TVLSLGRATA HCFKPYRRNN MRYQVFKTKE GGQPVFTAPW YWLASTIANW       300
     SSLKWDVCRI VDSKVNETRF CWAKALPAEK NN                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page