(data stored in ACNUC7421 zone)

EMBL: FN667743.PE18

FN667743.PE18        Location/Qualifiers
FT   CDS             13224..13886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0018"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0018"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92886"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGK0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92886.1"
FT                   /translation="MRKRDFFFGEVYEGSGVATLRLSDMESLARKVSAEFFTAQLNRML
FT                   KEHDGQLTLSDGTSYPSFWSFIDKVDTKQVGYVEIYARQDVNDNVEATLACDIVLVNGV
FT                   ITVKPHWCAYKDIRADEVISTLLVPLHLKALQDKAYIRWDDGETEPLLQNDYYQAELEN
FT                   VFSVSKYPSAMSWGDTADQKVKQYKMDLECATDVGRRGVSSEQAWDAYRELRHNRTM"
     MRKRDFFFGE VYEGSGVATL RLSDMESLAR KVSAEFFTAQ LNRMLKEHDG QLTLSDGTSY        60
     PSFWSFIDKV DTKQVGYVEI YARQDVNDNV EATLACDIVL VNGVITVKPH WCAYKDIRAD       120
     EVISTLLVPL HLKALQDKAY IRWDDGETEP LLQNDYYQAE LENVFSVSKY PSAMSWGDTA       180
     DQKVKQYKMD LECATDVGRR GVSSEQAWDA YRELRHNRTM                             220
//

If you have problems or comments...

PBIL Back to PBIL home page