(data stored in ACNUC7421 zone)

EMBL: FN667743.PE181

FN667743.PE181       Location/Qualifiers
FT   CDS             complement(150537..150887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0181"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0181"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ93049"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM97"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ93049.1"
FT                   /translation="MWAIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYAD
FT                   TVNGSSYSNMKELRVQSKGDPLRAFFAFDPKRKGILLCAGNKTGDEKRFYEVMIPIADR
FT                   EFAAHLDKLKKE"
     MWAIETTDTF DEWFDALDDT DRANVLASMM VLRDRGPMLS RPYADTVNGS SYSNMKELRV        60
     QSKGDPLRAF FAFDPKRKGI LLCAGNKTGD EKRFYEVMIP IADREFAAHL DKLKKE           116
//

If you have problems or comments...

PBIL Back to PBIL home page