(data stored in ACNUC7421 zone)

EMBL: FN667743.PE2

FN667743.PE2         Location/Qualifiers
FT   CDS             940..2115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0002"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0002"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92870"
FT                   /db_xref="GOA:D3VLR8"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR013741"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR042075"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLR8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92870.1"
FT                   /translation="MALNNLRGLSDLAKAAKGKKGKEVLTVPVDDVVSKVQVRKRFRNI
FT                   EELAATMLTEGQQSPIIVFPKNEEGKFVIQKGERRWRACKHAGIDTIDLVVNDKVQNNL
FT                   DETAGELIENIQRDDLTPVEIAEALNLFIEDGWKQKDIADRLGKNITFVSTHLSLLKLP
FT                   DCVRELYDNEVCSDTETLNNLRLLFDMNEERCRAVCAVAMSDGITRKQSRELLNDAKRI
FT                   KEEMEKGPLTGSGHNDEPGDGNTDDQTLNSNGNGTEEQLGNAEQNHNQNVLEDGSDRDG
FT                   LNDDDLDPLRDEEDKEPVQQPINSGKNKDDEGGDALPPLPKDKEWKNVRADSLVIAVNV
FT                   NLDGETKRGVIMTDRVALVPSTVWVKTLDSEGKEKHVHVPVSDIELLSVEG"
     MALNNLRGLS DLAKAAKGKK GKEVLTVPVD DVVSKVQVRK RFRNIEELAA TMLTEGQQSP        60
     IIVFPKNEEG KFVIQKGERR WRACKHAGID TIDLVVNDKV QNNLDETAGE LIENIQRDDL       120
     TPVEIAEALN LFIEDGWKQK DIADRLGKNI TFVSTHLSLL KLPDCVRELY DNEVCSDTET       180
     LNNLRLLFDM NEERCRAVCA VAMSDGITRK QSRELLNDAK RIKEEMEKGP LTGSGHNDEP       240
     GDGNTDDQTL NSNGNGTEEQ LGNAEQNHNQ NVLEDGSDRD GLNDDDLDPL RDEEDKEPVQ       300
     QPINSGKNKD DEGGDALPPL PKDKEWKNVR ADSLVIAVNV NLDGETKRGV IMTDRVALVP       360
     STVWVKTLDS EGKEKHVHVP VSDIELLSVE G                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page