(data stored in ACNUC7421 zone)

EMBL: FN667743.PE31

FN667743.PE31        Location/Qualifiers
FT   CDS             28870..30135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0031"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0031"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92899"
FT                   /db_xref="InterPro:IPR019106"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLU7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92899.1"
FT                   /translation="MIKSLAAHIPCSKTVLTVLMLSVAGGGVAQESPLTEQDRELIEQG
FT                   KQIAERTQKMEMPSLLQNQHMDQAQAEAKTFFKQLQSTNQTLKEMQLKQAEKGIYTDHR
FT                   ILVFASLSLGEQGLDDVLTAVSGQPDAVVVFRGIPEGMNLGQGVKAIQALAAKKDPVPN
FT                   IIINPTLFKTYKITAVPTIVMIEDEPLPGEQPNVVAKVSGLSDPVWLAREVDNGEKGDL
FT                   GVRGPVEKIGEADLIDVAKKRLANIDWEDKKKQAAERFWTKQNFNELPRASKARTREID
FT                   PSVMITSDISTPDGTVFAHAGDVINPLCDPKEVCKPGTRTFTQAVVVFAPLDKKQMELL
FT                   AKKLPEIKREPGVQRITYIATSFDKDKGWDSYKSVTDNFDAPVYLLTPDLITRFELEHT
FT                   PSVITSRGKMFVVRELTEEGDE"
     MIKSLAAHIP CSKTVLTVLM LSVAGGGVAQ ESPLTEQDRE LIEQGKQIAE RTQKMEMPSL        60
     LQNQHMDQAQ AEAKTFFKQL QSTNQTLKEM QLKQAEKGIY TDHRILVFAS LSLGEQGLDD       120
     VLTAVSGQPD AVVVFRGIPE GMNLGQGVKA IQALAAKKDP VPNIIINPTL FKTYKITAVP       180
     TIVMIEDEPL PGEQPNVVAK VSGLSDPVWL AREVDNGEKG DLGVRGPVEK IGEADLIDVA       240
     KKRLANIDWE DKKKQAAERF WTKQNFNELP RASKARTREI DPSVMITSDI STPDGTVFAH       300
     AGDVINPLCD PKEVCKPGTR TFTQAVVVFA PLDKKQMELL AKKLPEIKRE PGVQRITYIA       360
     TSFDKDKGWD SYKSVTDNFD APVYLLTPDL ITRFELEHTP SVITSRGKMF VVRELTEEGD       420
     E                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page