(data stored in ACNUC7421 zone)

EMBL: FN667743.PE32

FN667743.PE32        Location/Qualifiers
FT   CDS             30132..30803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0032"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0032"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92900"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLU8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92900.1"
FT                   /translation="MIFAPAFQPIKDVGTGLFVAAEVLARWYDEGRVLTPSSLLSQPHW
FT                   GLVDMEVARFIHKNLHQCLDLYPTLFLNVSEHTLRSDVIFKAWTRVIHAIAKNHSGRFV
FT                   IEITEGIQDASLSSRWDALIETGVELALDDYGDKHSSMERLSGYPWRYCKFDARRLRSL
FT                   EDYPAIVHCRRKGIQLIAEQVETFPLGESAKLLGLSWQQGFFHGKPAVMDKHLNNVKAL
FT                   P"
     MIFAPAFQPI KDVGTGLFVA AEVLARWYDE GRVLTPSSLL SQPHWGLVDM EVARFIHKNL        60
     HQCLDLYPTL FLNVSEHTLR SDVIFKAWTR VIHAIAKNHS GRFVIEITEG IQDASLSSRW       120
     DALIETGVEL ALDDYGDKHS SMERLSGYPW RYCKFDARRL RSLEDYPAIV HCRRKGIQLI       180
     AEQVETFPLG ESAKLLGLSW QQGFFHGKPA VMDKHLNNVK ALP                         223
//

If you have problems or comments...

PBIL Back to PBIL home page