(data stored in ACNUC7421 zone)

EMBL: FN667743.PE33

FN667743.PE33        Location/Qualifiers
FT   CDS             30800..31807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0033"
FT                   /product="Tra U protein (modular protein)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0033"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92901"
FT                   /db_xref="InterPro:IPR009649"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLU9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92901.1"
FT                   /translation="MIKKILRIMTVSAVFWVNSVSADPGCQNAEVIGGKLITDICWSCI
FT                   FPIKVAGVPISGGGGSFPSEAVSNPLCMCEDNLGVPRPGVTTSMWEPARLVEFQRVPGC
FT                   SSVLNGVRFPFDRTNQGHHGMGDMDGGDGSFMHYHYYAFPLLVMLDLFIKQTCNADGYM
FT                   DFDIMYMSELDPTWNNDEFAFFTNPEAAAVANPIAAAACTADAISSTAGKPLKQLFWCA
FT                   GSWGTLYPFSGNQNGGKGVIRDSSLLSTRVLAALHRRGLAWKTMGSEAMCRGVISPTLP
FT                   KTQYKFTLLHPVPETNSSHVIGESTLTWGLARTIPAIGQDPIYTIWRWNDCCNN"
     MIKKILRIMT VSAVFWVNSV SADPGCQNAE VIGGKLITDI CWSCIFPIKV AGVPISGGGG        60
     SFPSEAVSNP LCMCEDNLGV PRPGVTTSMW EPARLVEFQR VPGCSSVLNG VRFPFDRTNQ       120
     GHHGMGDMDG GDGSFMHYHY YAFPLLVMLD LFIKQTCNAD GYMDFDIMYM SELDPTWNND       180
     EFAFFTNPEA AAVANPIAAA ACTADAISST AGKPLKQLFW CAGSWGTLYP FSGNQNGGKG       240
     VIRDSSLLST RVLAALHRRG LAWKTMGSEA MCRGVISPTL PKTQYKFTLL HPVPETNSSH       300
     VIGESTLTWG LARTIPAIGQ DPIYTIWRWN DCCNN                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page