(data stored in ACNUC7421 zone)

EMBL: FN667743.PE34

FN667743.PE34        Location/Qualifiers
FT   CDS             31911..34727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0034"
FT                   /product="putative mating pair stabilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0034"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92902"
FT                   /db_xref="InterPro:IPR014121"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLV0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92902.1"
FT                   /translation="MENTMRSHNYFMRAVASLLTVTMSALPIHSYANGSQDQDITAVGK
FT                   EAQAFGQNLSNSFKSSSGTVQDGTISMPTLKDGQFQMNGGSQINVNDLFPGTSGTNNKP
FT                   DSYYFPDANKPDVGGLQGIYESGDDMDSVGNNAKGSLWSDANSANPSISGAAYKVLLDA
FT                   SNRSRPDFSNDPVLNLSKKTYEDMDLIADGFGDCSAETTINQNTINAHIPEYERCQRVV
FT                   DQSADCEVVHDYDASVVKHYDGPYNLKSCGEGCTELWIGRVGDNYWSGNCTIYEEYTRV
FT                   QVSNPDAIVSATLEYAKWDDYMQVWVGKSGQETKVWSGPDGNFPPETAGRCELSTSWER
FT                   NPNVDVTPYFKNVKDGDVVTFKIRVSVSGEGEGFGRIKLRYDPSKAITKDEWAPQSCMD
FT                   SAKGVVDGFAEGEITCIDDPTDATGCTVINGIKVCESQLKPSPLPGIPKLCKKVRVKAD
FT                   YDFYKGQMDCWTDPQGETHCPVNTGGNLNSCQKYEENPQCGFISSKCVDGAKGSSGTCY
FT                   VHEDTYDCGTDVSVPTLEKEIEYQCGGPIRCMGDDCLDLTKTQSTDFARATALLNAAQF
FT                   MTQDMSCTGQDGDDNPTGEENVICSAFAGEAGECKIAVGGVSDCCEKPTNISLADYLNL
FT                   IMAVPKLDGAVMGLTDGNALKGAYQVLREPALQGWTEVTKPFTSYIENVSGAVDSFFQP
FT                   VEQFIDQLIDQLKEQVKEVMMDVMKSAGQDAATEQAAAAASEQAAEAMMETATTWLSTA
FT                   MTIYTVYVVAMVMIQMIYKCEEEEFTMNAKRALKNCSYVGSYCKSKVLGACIEKREAYC
FT                   CFNSPLSRIIQEQVRPQLGQNFGDPKNPQCEGIPLDKIAEIDWSKINLDEWLGILQQNG
FT                   KFPDPNAINLDSLTGAGNDFNVDGTRKNAQERALERLEGIDIDAKRKEATNSIDPQTGA
FT                   PTSGGGGG"
     MENTMRSHNY FMRAVASLLT VTMSALPIHS YANGSQDQDI TAVGKEAQAF GQNLSNSFKS        60
     SSGTVQDGTI SMPTLKDGQF QMNGGSQINV NDLFPGTSGT NNKPDSYYFP DANKPDVGGL       120
     QGIYESGDDM DSVGNNAKGS LWSDANSANP SISGAAYKVL LDASNRSRPD FSNDPVLNLS       180
     KKTYEDMDLI ADGFGDCSAE TTINQNTINA HIPEYERCQR VVDQSADCEV VHDYDASVVK       240
     HYDGPYNLKS CGEGCTELWI GRVGDNYWSG NCTIYEEYTR VQVSNPDAIV SATLEYAKWD       300
     DYMQVWVGKS GQETKVWSGP DGNFPPETAG RCELSTSWER NPNVDVTPYF KNVKDGDVVT       360
     FKIRVSVSGE GEGFGRIKLR YDPSKAITKD EWAPQSCMDS AKGVVDGFAE GEITCIDDPT       420
     DATGCTVING IKVCESQLKP SPLPGIPKLC KKVRVKADYD FYKGQMDCWT DPQGETHCPV       480
     NTGGNLNSCQ KYEENPQCGF ISSKCVDGAK GSSGTCYVHE DTYDCGTDVS VPTLEKEIEY       540
     QCGGPIRCMG DDCLDLTKTQ STDFARATAL LNAAQFMTQD MSCTGQDGDD NPTGEENVIC       600
     SAFAGEAGEC KIAVGGVSDC CEKPTNISLA DYLNLIMAVP KLDGAVMGLT DGNALKGAYQ       660
     VLREPALQGW TEVTKPFTSY IENVSGAVDS FFQPVEQFID QLIDQLKEQV KEVMMDVMKS       720
     AGQDAATEQA AAAASEQAAE AMMETATTWL STAMTIYTVY VVAMVMIQMI YKCEEEEFTM       780
     NAKRALKNCS YVGSYCKSKV LGACIEKREA YCCFNSPLSR IIQEQVRPQL GQNFGDPKNP       840
     QCEGIPLDKI AEIDWSKINL DEWLGILQQN GKFPDPNAIN LDSLTGAGND FNVDGTRKNA       900
     QERALERLEG IDIDAKRKEA TNSIDPQTGA PTSGGGGG                               938
//

If you have problems or comments...

PBIL Back to PBIL home page