(data stored in ACNUC7421 zone)

EMBL: FN667743.PE35

FN667743.PE35        Location/Qualifiers
FT   CDS             complement(34765..35628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0035"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0035"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92903"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLV1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92903.1"
FT                   /translation="MNKTLITTVALAVATLSGCASTSSNYEPSAYKANQSRAYNIAEAG
FT                   GLVTGIKDAPVPRDKLERLTDTKTFGAAYVLSGYTSPQLGMTNWQGGLVNFANWAIVPK
FT                   QHGARNSLVAWMPAHEADSPAKAQAKFLSHVKVSIESALTDLGADFTLLYDKDGRLTYQ
FT                   FYKNEWGCPTWVNGQSKAADMCSVKVKLVEPRIGVAPDFVSSVQGAAYAFTSGHETAYN
FT                   FVNVGNGTTSHAPQQAIYAAISKQLPAWTYLYLAPKSVELENGEKVAFPYLLEQGKAEL
FT                   FVYPEA"
     MNKTLITTVA LAVATLSGCA STSSNYEPSA YKANQSRAYN IAEAGGLVTG IKDAPVPRDK        60
     LERLTDTKTF GAAYVLSGYT SPQLGMTNWQ GGLVNFANWA IVPKQHGARN SLVAWMPAHE       120
     ADSPAKAQAK FLSHVKVSIE SALTDLGADF TLLYDKDGRL TYQFYKNEWG CPTWVNGQSK       180
     AADMCSVKVK LVEPRIGVAP DFVSSVQGAA YAFTSGHETA YNFVNVGNGT TSHAPQQAIY       240
     AAISKQLPAW TYLYLAPKSV ELENGEKVAF PYLLEQGKAE LFVYPEA                     287
//

If you have problems or comments...

PBIL Back to PBIL home page