(data stored in ACNUC7421 zone)

EMBL: FN667743.PE36

FN667743.PE36        Location/Qualifiers
FT   CDS             complement(35750..36466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0036"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0036"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92904"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLV2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92904.1"
FT                   /translation="MSGYRLTAFILSSAFICTSNLGVSLMAEAQAAVDTNSDRSNHYSR
FT                   PIFKQALKVNSLQAQRVMERSFERVSNSLFSIDVILRIIGEQDEIDQVETVILEQISKV
FT                   SEDLDKATAQLNKLMEDNGIDMMPGYTNPNEYTIEINSPQVAQFAHLIRKLDKLMGIVD
FT                   TLWLNTVLTSKQRTDATYQWQQRLIKLAGRIIGIEKRARISAHTKGKEGEVAQAAPESE
FT                   TGDKEIADEAEKTKAA"
     MSGYRLTAFI LSSAFICTSN LGVSLMAEAQ AAVDTNSDRS NHYSRPIFKQ ALKVNSLQAQ        60
     RVMERSFERV SNSLFSIDVI LRIIGEQDEI DQVETVILEQ ISKVSEDLDK ATAQLNKLME       120
     DNGIDMMPGY TNPNEYTIEI NSPQVAQFAH LIRKLDKLMG IVDTLWLNTV LTSKQRTDAT       180
     YQWQQRLIKL AGRIIGIEKR ARISAHTKGK EGEVAQAAPE SETGDKEIAD EAEKTKAA         238
//

If you have problems or comments...

PBIL Back to PBIL home page