(data stored in ACNUC7421 zone)

EMBL: FN667743.PE46

FN667743.PE46        Location/Qualifiers
FT   CDS             43409..45205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0046"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0046"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92914"
FT                   /db_xref="GOA:D3VLW2"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR006538"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLW2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92914.1"
FT                   /translation="MSKKRTIYSALPIVAAAYGEKLGVKVAIGNDDAYTDGKTIVVPNI
FT                   PDDYPNMDAVWGYLAHEAAHVRFTDFGVERRRGLHAELSNVLEDCRIERAMMDLFPGTS
FT                   QTLNEVARYMAQAGHYEHVTDKEAPASILTGFCLYWLQTKAVGQSVLQPYLDSATTVFE
FT                   RVFPQGVVVRLNALLRKAVNTKSTAEVVSLADQIIKMIEEEKEKEEQKPKNGQDGNNQQ
FT                   NAGGDQPQNNQGGSGNDQNQGPSAGGSDQQGKNQKQDEAGGKSDPKGQGDQAKSDADGG
FT                   SKAGQSQAGGNSDAAKQDAAKMLQQVLNAGAGDLRGDAHDALKAELNRVAQDKGDNSYM
FT                   TVRSAVDTQNNPAVGKSLVGDVKSTTSKIRTQLYGLVQASQRVAHRNQRSGKRVDARKL
FT                   HRVVTGDTRVFLKPEAKKRPNTAVHILVDMSSSMAYKAANGKERQDIAREASLAISMAL
FT                   EAIPGVNPAVTFFGGNRNQPVFSVVKHGDTVQNRAGRFGFKATGGTPMAEAMWYAAFEL
FT                   TKTREERKMLIVVTDGLPQSAPACRSVIDLCERSDVEVIGIGVETTAVSGLFQKNIVID
FT                   DAAALQRTLFKLMERSLTAFAA"
     MSKKRTIYSA LPIVAAAYGE KLGVKVAIGN DDAYTDGKTI VVPNIPDDYP NMDAVWGYLA        60
     HEAAHVRFTD FGVERRRGLH AELSNVLEDC RIERAMMDLF PGTSQTLNEV ARYMAQAGHY       120
     EHVTDKEAPA SILTGFCLYW LQTKAVGQSV LQPYLDSATT VFERVFPQGV VVRLNALLRK       180
     AVNTKSTAEV VSLADQIIKM IEEEKEKEEQ KPKNGQDGNN QQNAGGDQPQ NNQGGSGNDQ       240
     NQGPSAGGSD QQGKNQKQDE AGGKSDPKGQ GDQAKSDADG GSKAGQSQAG GNSDAAKQDA       300
     AKMLQQVLNA GAGDLRGDAH DALKAELNRV AQDKGDNSYM TVRSAVDTQN NPAVGKSLVG       360
     DVKSTTSKIR TQLYGLVQAS QRVAHRNQRS GKRVDARKLH RVVTGDTRVF LKPEAKKRPN       420
     TAVHILVDMS SSMAYKAANG KERQDIAREA SLAISMALEA IPGVNPAVTF FGGNRNQPVF       480
     SVVKHGDTVQ NRAGRFGFKA TGGTPMAEAM WYAAFELTKT REERKMLIVV TDGLPQSAPA       540
     CRSVIDLCER SDVEVIGIGV ETTAVSGLFQ KNIVIDDAAA LQRTLFKLME RSLTAFAA         598
//

If you have problems or comments...

PBIL Back to PBIL home page