(data stored in ACNUC7421 zone)

EMBL: FN667743.PE48

FN667743.PE48        Location/Qualifiers
FT   CDS             46497..46997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0048"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0048"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92916"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLW4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92916.1"
FT                   /translation="MKKLSALESVLNHDKPSRRFLDGLNENQMKDLSGEIFAKLYWSKR
FT                   NPQWYEKDTKRLFARLRWIQRIIKKRLKTGKVKPELTEHGSVMERFNFPYGDTLDFFHR
FT                   YLRHPKWEVVYQESGCSAFWKNEATLELCTYCEGDVVMMKAPDKVAFFRDCNRLSWWYA
FT                   ENA"
     MKKLSALESV LNHDKPSRRF LDGLNENQMK DLSGEIFAKL YWSKRNPQWY EKDTKRLFAR        60
     LRWIQRIIKK RLKTGKVKPE LTEHGSVMER FNFPYGDTLD FFHRYLRHPK WEVVYQESGC       120
     SAFWKNEATL ELCTYCEGDV VMMKAPDKVA FFRDCNRLSW WYAENA                      166
//

If you have problems or comments...

PBIL Back to PBIL home page