(data stored in ACNUC7421 zone)

EMBL: FN667743.PE53

FN667743.PE53        Location/Qualifiers
FT   CDS             48628..49140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0053"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0053"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92921"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLW9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92921.1"
FT                   /translation="MEWSNLAMTSKKARVLEVVMQLNRYTARESDKSRILRIIGWCKRN
FT                   HLTLAGLPYDDNLSGSEGISLEIITPPGMSREMLEQAVKEGYSERDVIRHRILECPIRW
FT                   FIEADEKAFDHELFHDYVVAHGYDEPSSEVYELAETWLWQGKDYALIAAEEIVARDLCV
FT                   RDDENEG"
     MEWSNLAMTS KKARVLEVVM QLNRYTARES DKSRILRIIG WCKRNHLTLA GLPYDDNLSG        60
     SEGISLEIIT PPGMSREMLE QAVKEGYSER DVIRHRILEC PIRWFIEADE KAFDHELFHD       120
     YVVAHGYDEP SSEVYELAET WLWQGKDYAL IAAEEIVARD LCVRDDENEG                  170
//

If you have problems or comments...

PBIL Back to PBIL home page