(data stored in ACNUC7421 zone)

EMBL: FN667743.PE57

FN667743.PE57        Location/Qualifiers
FT   CDS             51636..52112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0057"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92925"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLX3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92925.1"
FT                   /translation="MPKGLCSGLSERRVIMKIETVVPLPPEDSGLQHCIARFHNRNMDS
FT                   KRKDKNRFFRREPVMIVNPETKAKVLRYAMGNPGNLSITKLAVALDYDAVDALGVRFKD
FT                   TVNLEVRRARRWEVWQWFWNHPDQSVQLSIKLGVVGAVLGVMGFLTGVAPYLLG"
     MPKGLCSGLS ERRVIMKIET VVPLPPEDSG LQHCIARFHN RNMDSKRKDK NRFFRREPVM        60
     IVNPETKAKV LRYAMGNPGN LSITKLAVAL DYDAVDALGV RFKDTVNLEV RRARRWEVWQ       120
     WFWNHPDQSV QLSIKLGVVG AVLGVMGFLT GVAPYLLG                               158
//

If you have problems or comments...

PBIL Back to PBIL home page