(data stored in ACNUC7421 zone)

EMBL: FN667743.PE61

FN667743.PE61        Location/Qualifiers
FT   CDS             53756..56122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0061"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92929"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLX7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92929.1"
FT                   /translation="MGCFPGRDGHPANPGGPMQQALNFDLSEQPLPVLLRGDKWDSVWS
FT                   ELTDNEDLNFVDASRGTSLSSLITSSVEAIHTALIDGWTMMIGYSSGKDSETVLHLFLM
FT                   ALIRAVRSGATISQHHFILHTDTLIESPEVRWLADQKLAELERFIAKENLPLTIVLAKP
FT                   GISQSWTGRILTGRGLPTFSNSTARQCSQDLKITSAKRAKAAYMRELPKEVRQKVCLLL
FT                   GSRDAESTIRAASIAKQRGSSDRVIKTKDGGELYVVKNWLASDVWEFLLSAGMGSTYPL
FT                   PSYLESNVTTAELYKAATGECVWSATEKKASDACGARFGCWACQAVGLDKSMETLLATD
FT                   PERHGYMSGLNRIQRYLAKRRYAWEDRHPVGRTIYEGGYIKIQPDVYSPVFLERLLHVC
FT                   CSMDYMEQKRADELAYKLATGQTEDNDWNRRMAEPQFRIISEEALVHIDFMWAFHHFND
FT                   KPFHALEIYHRVWSMGDLDLLEDEPQCETVPQSPIPKPLWLKVGRWGDGSLSDGLADPL
FT                   AEMAYFDGGDDPLAAKVINTADGKRRVVCFAEDDEVKVDPDSAAFIIWNEYPRLRESVL
FT                   KGHYTPGSAAQFYLRFGAIQLAKGKGALYHRMMQRGQTYHQMGLTGLQTMEGIQQRKDV
FT                   KVLSDAKYKDLVRRKIKGRLATVRWWVNLHLTFKYHLHHRTPTGLFIEKQLNQEAMEEQ
FT                   KRHQARWFNYVTDAMLCYSSAFCMSVMEGREGSGNTNIRRYMIATRRKAYTALCELLNN
FT                   TDAPWVSDVLQGALGQYESIQAALTEGSALTIYTQ"
     MGCFPGRDGH PANPGGPMQQ ALNFDLSEQP LPVLLRGDKW DSVWSELTDN EDLNFVDASR        60
     GTSLSSLITS SVEAIHTALI DGWTMMIGYS SGKDSETVLH LFLMALIRAV RSGATISQHH       120
     FILHTDTLIE SPEVRWLADQ KLAELERFIA KENLPLTIVL AKPGISQSWT GRILTGRGLP       180
     TFSNSTARQC SQDLKITSAK RAKAAYMREL PKEVRQKVCL LLGSRDAEST IRAASIAKQR       240
     GSSDRVIKTK DGGELYVVKN WLASDVWEFL LSAGMGSTYP LPSYLESNVT TAELYKAATG       300
     ECVWSATEKK ASDACGARFG CWACQAVGLD KSMETLLATD PERHGYMSGL NRIQRYLAKR       360
     RYAWEDRHPV GRTIYEGGYI KIQPDVYSPV FLERLLHVCC SMDYMEQKRA DELAYKLATG       420
     QTEDNDWNRR MAEPQFRIIS EEALVHIDFM WAFHHFNDKP FHALEIYHRV WSMGDLDLLE       480
     DEPQCETVPQ SPIPKPLWLK VGRWGDGSLS DGLADPLAEM AYFDGGDDPL AAKVINTADG       540
     KRRVVCFAED DEVKVDPDSA AFIIWNEYPR LRESVLKGHY TPGSAAQFYL RFGAIQLAKG       600
     KGALYHRMMQ RGQTYHQMGL TGLQTMEGIQ QRKDVKVLSD AKYKDLVRRK IKGRLATVRW       660
     WVNLHLTFKY HLHHRTPTGL FIEKQLNQEA MEEQKRHQAR WFNYVTDAML CYSSAFCMSV       720
     MEGREGSGNT NIRRYMIATR RKAYTALCEL LNNTDAPWVS DVLQGALGQY ESIQAALTEG       780
     SALTIYTQ                                                                788
//

If you have problems or comments...

PBIL Back to PBIL home page