(data stored in ACNUC7421 zone)

EMBL: FN667743.PE66

FN667743.PE66        Location/Qualifiers
FT   CDS             57954..58541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0066"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0066"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92934"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLY2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92934.1"
FT                   /translation="MVRPNYKECTMSNFEQALERTDGKTLILSNGSKWAGQDPDNIQTL
FT                   LDVLGNNVLDPMFEQYHCYRSYPFEPLIKTGRNDKIFQPWLGAACFFGNFLTVSHVFNI
FT                   ITKDDSVVEALNEAIQKNIATEQYQQYAYERYAGWFYAETSEGFRLVSPSEAADIRAGA
FT                   VSKLRYPRNFEVMKTAVIKGPRFDAELSRKAS"
     MVRPNYKECT MSNFEQALER TDGKTLILSN GSKWAGQDPD NIQTLLDVLG NNVLDPMFEQ        60
     YHCYRSYPFE PLIKTGRNDK IFQPWLGAAC FFGNFLTVSH VFNIITKDDS VVEALNEAIQ       120
     KNIATEQYQQ YAYERYAGWF YAETSEGFRL VSPSEAADIR AGAVSKLRYP RNFEVMKTAV       180
     IKGPRFDAEL SRKAS                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page