(data stored in ACNUC7421 zone)

EMBL: FN667743.PE72

FN667743.PE72        Location/Qualifiers
FT   CDS             62811..62927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0072"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0072"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92940"
FT                   /db_xref="GOA:D3VLY8"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLY8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92940.1"
FT                   /translation="MDAFTLGMLGLLLFFTVVTGGSLYLYHEKQKEKKHHNA"
     MDAFTLGMLG LLLFFTVVTG GSLYLYHEKQ KEKKHHNA                                38
//

If you have problems or comments...

PBIL Back to PBIL home page