(data stored in ACNUC7421 zone)

EMBL: FN667743.PE73

FN667743.PE73        Location/Qualifiers
FT   CDS             complement(63057..64457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0073"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0073"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92941"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLY9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92941.1"
FT                   /translation="MQLTIQIATVDKSGHRHTEKLLAIEKQTDSPNDIGLSLSESKQLL
FT                   NTVQQSVIQKQAAEFLDEHRPCPCCQRNRRIKGRQKIQYRTLFGIIPVEGFRVYRCICE
FT                   KNSPQTVNLLNDWCSEYTHPELKYIETKWASLMAYGLTASLLKDILPVGERCNAATIRN
FT                   HLCQTAKRQEAELDGLPDFLSGSPREWAKLPKPGKPMTVGIDGGYVRNRDDKKHHFEII
FT                   AGKSFSADVPAKRFGFVQCLENHPRRKLLAQLSSQGMQANQQITFLSDGADNLRELQFN
FT                   LYPESQHILDWFHITMRLTVLKQYSKGVSKNDPELGTELLDSLTRTKWYIWHGNVIKAL
FT                   EHLDDCAAMCDEDISHYGNNKSLLKHIDEMYTYIENNSMMIPNYGEMYRYGEAISSSFV
FT                   ESTINEVIAKRMVKKQQMQWSQQGAHYLLQTRTAVLNGDLKTQFEHWYPGIKLGDKTDH
FT                   YWTEAVAA"
     MQLTIQIATV DKSGHRHTEK LLAIEKQTDS PNDIGLSLSE SKQLLNTVQQ SVIQKQAAEF        60
     LDEHRPCPCC QRNRRIKGRQ KIQYRTLFGI IPVEGFRVYR CICEKNSPQT VNLLNDWCSE       120
     YTHPELKYIE TKWASLMAYG LTASLLKDIL PVGERCNAAT IRNHLCQTAK RQEAELDGLP       180
     DFLSGSPREW AKLPKPGKPM TVGIDGGYVR NRDDKKHHFE IIAGKSFSAD VPAKRFGFVQ       240
     CLENHPRRKL LAQLSSQGMQ ANQQITFLSD GADNLRELQF NLYPESQHIL DWFHITMRLT       300
     VLKQYSKGVS KNDPELGTEL LDSLTRTKWY IWHGNVIKAL EHLDDCAAMC DEDISHYGNN       360
     KSLLKHIDEM YTYIENNSMM IPNYGEMYRY GEAISSSFVE STINEVIAKR MVKKQQMQWS       420
     QQGAHYLLQT RTAVLNGDLK TQFEHWYPGI KLGDKTDHYW TEAVAA                      466
//

If you have problems or comments...

PBIL Back to PBIL home page