(data stored in ACNUC7421 zone)

EMBL: FN667743.PE8

FN667743.PE8         Location/Qualifiers
FT   CDS             4207..4488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0008"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0008"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92876"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLS4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92876.1"
FT                   /translation="MNHATASPMSRVPIFVRAMQRGALSVYTKDKNNAYSLSAAGKAFV
FT                   SQLHKKTFDPDLPFRINDWLNRGDYDAMSRYIRTVFGRQIRFQRNLGN"
     MNHATASPMS RVPIFVRAMQ RGALSVYTKD KNNAYSLSAA GKAFVSQLHK KTFDPDLPFR        60
     INDWLNRGDY DAMSRYIRTV FGRQIRFQRN LGN                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page