(data stored in ACNUC7421 zone)

EMBL: FN667743.PE80

FN667743.PE80        Location/Qualifiers
FT   CDS             complement(67351..69318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0080"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0080"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92948"
FT                   /db_xref="GOA:D3VLZ6"
FT                   /db_xref="InterPro:IPR005638"
FT                   /db_xref="InterPro:IPR005639"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR036716"
FT                   /db_xref="InterPro:IPR038979"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLZ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92948.1"
FT                   /translation="MNDDYAEKNISPISIETPEDLHIAITAITGIAVAITGPFFPLTSA
FT                   IIATSLAIFPVLFKPENKVDVFDTISNSINSLIDQKIDQAIYDNSKQHLIGIANLFEGF
FT                   SKELKEWEENKTIGTETIRREIYYLDNELTSSMPLFQHPKQRGSLLPLFANAAYRHITL
FT                   LYTAITYYDELNFNDNIEPSSRVTKNHFIEKIKKLIKEYSDYSCEVYNKELNKITYNDK
FT                   KTWIDLNEYRNICTSSVHAYIMMLDFFNPEIYPLDRLVDKRGYYRVIQNVVKDTDFDRS
FT                   LSTRQFDKDISNHYAVGKLYSIEFGKIDRLYIDPYTVRGLVYTLSTLKQFNDITISIGN
FT                   KLNNVHNSEKIYFYNKELTGVKGIYPLYKQHNSLITPTVCLQEMTFKDGDLPTTGNEIH
FT                   LLFVRDPKDYKLKFKEFKLGRYLNVSDYLDVKDELEYLKDIPQLLFMKTLTGGDGSIRN
FT                   KYNTINIFGWRFKYFIDFKPSTNAFNLNEMKTQIYYSITSSKYNKDNEIHPLDRDSIIS
FT                   NLGFSQGAVVRIRKDERIIFLLAKSDLEPNRWIFPGDYKIRLWHIKVKNAKVNISISQT
FT                   DGKGNVDCHSINMELNNHDMKDDIEDEYIYSDLCFKQTDNHHDFVIKDNIYQINILIKN
FT                   ISTNKVIIDRIELIPVFTSP"
     MNDDYAEKNI SPISIETPED LHIAITAITG IAVAITGPFF PLTSAIIATS LAIFPVLFKP        60
     ENKVDVFDTI SNSINSLIDQ KIDQAIYDNS KQHLIGIANL FEGFSKELKE WEENKTIGTE       120
     TIRREIYYLD NELTSSMPLF QHPKQRGSLL PLFANAAYRH ITLLYTAITY YDELNFNDNI       180
     EPSSRVTKNH FIEKIKKLIK EYSDYSCEVY NKELNKITYN DKKTWIDLNE YRNICTSSVH       240
     AYIMMLDFFN PEIYPLDRLV DKRGYYRVIQ NVVKDTDFDR SLSTRQFDKD ISNHYAVGKL       300
     YSIEFGKIDR LYIDPYTVRG LVYTLSTLKQ FNDITISIGN KLNNVHNSEK IYFYNKELTG       360
     VKGIYPLYKQ HNSLITPTVC LQEMTFKDGD LPTTGNEIHL LFVRDPKDYK LKFKEFKLGR       420
     YLNVSDYLDV KDELEYLKDI PQLLFMKTLT GGDGSIRNKY NTINIFGWRF KYFIDFKPST       480
     NAFNLNEMKT QIYYSITSSK YNKDNEIHPL DRDSIISNLG FSQGAVVRIR KDERIIFLLA       540
     KSDLEPNRWI FPGDYKIRLW HIKVKNAKVN ISISQTDGKG NVDCHSINME LNNHDMKDDI       600
     EDEYIYSDLC FKQTDNHHDF VIKDNIYQIN ILIKNISTNK VIIDRIELIP VFTSP            655
//

If you have problems or comments...

PBIL Back to PBIL home page