(data stored in ACNUC7421 zone)

EMBL: FN667743.PE85

FN667743.PE85        Location/Qualifiers
FT   CDS             complement(74704..74970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0085"
FT                   /product="putative regulator with homeodomain-like DNA
FT                   binding domain (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0085"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92953"
FT                   /db_xref="GOA:D3VM01"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM01"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92953.1"
FT                   /translation="MLYTSNPIIKHKAGLLNLAEELSNVSRACKVMGVSRDTFYRYQEL
FT                   VETGGIDALINQSRKTPNLKNRVDAETEHAVMGFGEQRNSKHR"
     MLYTSNPIIK HKAGLLNLAE ELSNVSRACK VMGVSRDTFY RYQELVETGG IDALINQSRK        60
     TPNLKNRVDA ETEHAVMGFG EQRNSKHR                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page