(data stored in ACNUC7421 zone)

EMBL: FN667743.PE89

FN667743.PE89        Location/Qualifiers
FT   CDS             complement(77197..78393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0089"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0089"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92957"
FT                   /db_xref="GOA:D3VM05"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM05"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92957.1"
FT                   /translation="MNILAIIIIGCLTQFSSIGIISTAISKLELIDSMGIYSSSITIAN
FT                   SLGISFTGVLLGWVLSKYQGFRVGFFGPVISSSLIPILIFTNNIYVVLFAIFMLSIIIG
FT                   LDNPNNNSSLNKLIKLDKDKAHNFTKYTTAVQTSLIISPLLSAAIIVSFGHNLSFVFFM
FT                   IFYLVTCVPWILSPELRKMRTNKEVSSTDVWLGYKIISNNAPLKGLTINRILNNLIFTG
FT                   VIVLIPIMVAKSSVSNDQFTVIQNIILSFISAGFVVNGLISNEVLKNNPKIVSMFSKSS
FT                   TIFAIAAIVIASIFKFDKYSLYVMAAILGWGQFYFRIAGMTLGQAITPQEHLGEVILAS
FT                   DTIVRGITAMYSVVLLFLVNKFSSFIPFFLFVSIGSIAPFFLAKSAKIYIDKISKEDK"
     MNILAIIIIG CLTQFSSIGI ISTAISKLEL IDSMGIYSSS ITIANSLGIS FTGVLLGWVL        60
     SKYQGFRVGF FGPVISSSLI PILIFTNNIY VVLFAIFMLS IIIGLDNPNN NSSLNKLIKL       120
     DKDKAHNFTK YTTAVQTSLI ISPLLSAAII VSFGHNLSFV FFMIFYLVTC VPWILSPELR       180
     KMRTNKEVSS TDVWLGYKII SNNAPLKGLT INRILNNLIF TGVIVLIPIM VAKSSVSNDQ       240
     FTVIQNIILS FISAGFVVNG LISNEVLKNN PKIVSMFSKS STIFAIAAIV IASIFKFDKY       300
     SLYVMAAILG WGQFYFRIAG MTLGQAITPQ EHLGEVILAS DTIVRGITAM YSVVLLFLVN       360
     KFSSFIPFFL FVSIGSIAPF FLAKSAKIYI DKISKEDK                               398
//

If you have problems or comments...

PBIL Back to PBIL home page