(data stored in ACNUC7421 zone)

EMBL: FN667743.PE97

FN667743.PE97        Location/Qualifiers
FT   CDS             85243..86118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_p0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0097"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92965"
FT                   /db_xref="GOA:D3VM13"
FT                   /db_xref="InterPro:IPR008865"
FT                   /db_xref="InterPro:IPR036381"
FT                   /db_xref="InterPro:IPR036384"
FT                   /db_xref="UniProtKB/TrEMBL:D3VM13"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92965.1"
FT                   /translation="MAKNFISEQFSAMCRDLTNLSSIIKRLPPRYAKVAAIPPTRKGME
FT                   NERINNIVVTEQIGREALELAAHSYKDLHINPDYSQKSARRTVGVLWFSPSKVGLAAKI
FT                   AATVDRINAAKAGIEEFIISTYPSRQERFEALRVDCPGVMTLHLYRQIRCYSSGDIDSI
FT                   RFTWQRKDSLKKPVKEELLQRIREELERSGADYQLPLEQLIQRIVSTPEPYLRERREVK
FT                   VQPVANVMAAGVLKTVTAPMPLILLQDKDVELKMLRSFDASEQRKTRSDKSASEILGTF
FT                   GGVTIESTPE"
     MAKNFISEQF SAMCRDLTNL SSIIKRLPPR YAKVAAIPPT RKGMENERIN NIVVTEQIGR        60
     EALELAAHSY KDLHINPDYS QKSARRTVGV LWFSPSKVGL AAKIAATVDR INAAKAGIEE       120
     FIISTYPSRQ ERFEALRVDC PGVMTLHLYR QIRCYSSGDI DSIRFTWQRK DSLKKPVKEE       180
     LLQRIREELE RSGADYQLPL EQLIQRIVST PEPYLRERRE VKVQPVANVM AAGVLKTVTA       240
     PMPLILLQDK DVELKMLRSF DASEQRKTRS DKSASEILGT FGGVTIESTP E                291
//

If you have problems or comments...

PBIL Back to PBIL home page