(data stored in ACNUC7421 zone)

EMBL: FN667743.SOJ

FN667743.SOJ         Location/Qualifiers
FT   CDS             145..936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soj"
FT                   /locus_tag="XNC1_p0001"
FT                   /product="chromosome partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_p0001"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ92869"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3VLR7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ92869.1"
FT                   /translation="MGMAKVISFANQKGGVGKSTLCIQQAFYLALQKKKKVLVLDMDGQ
FT                   GNTSSRLAPRRELEDGDYEPILTGTKTAELFAYELDGIDVMHCPCGADLIHTPKNDPDL
FT                   FEMEAVPLDQAMNPARHLAALFENYDYVLIDCPPSLGRKLVAALVMSTHVACPVKLSGF
FT                   AVDGVEGLLNTIIGVREAYNSELNILGIIINDMDGSVNHAKSLHKLEKEIPDFLFKNKI
FT                   MHRPPLDTATTDGIPVWDLRYGHVAAREVEAVLEEILEKVG"
     MGMAKVISFA NQKGGVGKST LCIQQAFYLA LQKKKKVLVL DMDGQGNTSS RLAPRRELED        60
     GDYEPILTGT KTAELFAYEL DGIDVMHCPC GADLIHTPKN DPDLFEMEAV PLDQAMNPAR       120
     HLAALFENYD YVLIDCPPSL GRKLVAALVM STHVACPVKL SGFAVDGVEG LLNTIIGVRE       180
     AYNSELNILG IIINDMDGSV NHAKSLHKLE KEIPDFLFKN KIMHRPPLDT ATTDGIPVWD       240
     LRYGHVAARE VEAVLEEILE KVG                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page