(data stored in ACNUC30630 zone)

EMBL: FP565814.BIRA

FP565814.BIRA        Location/Qualifiers
FT   CDS             complement(744021..744818)
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="SRM_00612"
FT                   /product="Biotin--acetyl-CoA-carboxylase ligase"
FT                   /function="BirA acts both as a biotin-operon repressor and
FT                   as the enzyme that synthesizes the corepressor, acetyl-
FT                   CoA:carbon-dioxide ligase."
FT                   /EC_number="6.3.4.15"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00612"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23533"
FT                   /db_xref="GOA:D5H678"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:D5H678"
FT                   /protein_id="CBH23533.1"
FT                   /translation="MSLPLAADTQGRLSTDRFGRSMRGFEEVGSTNERAAQWAAAGAPE
FT                   GATVLTEYQTTGRGRHGRDWTADKGRNLLFSVVLRPTLPPDRFGLLTVAAGVAVAEAIE
FT                   DFVSPHSAALKWPNDVLLEGRKACGILLESSLAPPNTDAVVVLGVGLNVNQTDFPDALA
FT                   DTATSLRLASGRPLPRPPLLARLLRALERRYDAVQHNGAGSVRGAFRERLAALGSSLSL
FT                   RLPGTDETLSGTVQGITETGALRLRTADGVEKTVHAGEVTTRR"
     MSLPLAADTQ GRLSTDRFGR SMRGFEEVGS TNERAAQWAA AGAPEGATVL TEYQTTGRGR        60
     HGRDWTADKG RNLLFSVVLR PTLPPDRFGL LTVAAGVAVA EAIEDFVSPH SAALKWPNDV       120
     LLEGRKACGI LLESSLAPPN TDAVVVLGVG LNVNQTDFPD ALADTATSLR LASGRPLPRP       180
     PLLARLLRAL ERRYDAVQHN GAGSVRGAFR ERLAALGSSL SLRLPGTDET LSGTVQGITE       240
     TGALRLRTAD GVEKTVHAGE VTTRR                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page