(data stored in ACNUC30630 zone)

EMBL: FP565814.ETP

FP565814.ETP         Location/Qualifiers
FT   CDS             716470..716874
FT                   /transl_table=11
FT                   /gene="etp"
FT                   /locus_tag="SRM_00583"
FT                   /product="Low molecular weight
FT                   protein-tyrosine-phosphatase"
FT                   /function="Dephosphorylates etk"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00583"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23504"
FT                   /db_xref="GOA:D5H649"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:D5H649"
FT                   /protein_id="CBH23504.1"
FT                   /translation="MSAQYLFVCTGNTCRSPLAEALAEARGVSAESAGVAAGPGDGAAP
FT                   NADRALREARGLSLRGHTPRDVSAVDLTAAGRIVAMSPAVARRLRDDHDWAPDAMVTWA
FT                   VPDPYGGSLADYRWCLEEISAALDDLLASG"
     MSAQYLFVCT GNTCRSPLAE ALAEARGVSA ESAGVAAGPG DGAAPNADRA LREARGLSLR        60
     GHTPRDVSAV DLTAAGRIVA MSPAVARRLR DDHDWAPDAM VTWAVPDPYG GSLADYRWCL       120
     EEISAALDDL LASG                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page