(data stored in ACNUC30630 zone)

EMBL: FP565814.LEPA

FP565814.LEPA        Location/Qualifiers
FT   CDS             588264..590147
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="SRM_00483"
FT                   /product="GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00483"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23404"
FT                   /db_xref="GOA:D5H5U9"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5U9"
FT                   /protein_id="CBH23404.1"
FT                   /translation="MQPTGPAAPRPFTGRPSDGLSCLMPDLSTIRNFCIIAHIDHGKST
FT                   LADRLLERTGTITEREMKEQTLDDMDLERERGITIKSHAVRMAHTAPDGQEYTLNLIDT
FT                   PGHVDFTYEVSRALKACEGAILLVDAAQGIEAQTISNLWLALEQDLEIIPVINKIDLPV
FT                   ARPDEVAQALEDLIGEPAEDILQISAKTGEGVDEMLDLMIDRVPPPSGDPDAPLRALIF
FT                   DSIYDSYRGSVVYARVFDGTLEAGDTMEFMSNKKQYDAEEMGILRMGRQKVDTFTAGDV
FT                   GYIIGSIKDIQDARVGDTITTAHDPAEEPIPGFEEVKPMVFSGIYPTETDDFEELRGAL
FT                   EKLQLNDASLTYQAESSSALGYGFRVGFLGLLHMEIIQERLEREFDLDIITTVPNVEYE
FT                   VEVEEKGEPKTVTVDKPEDMPHYGDIEAVHEPYVKADIITPSDYIGNVIELCEKRRGEY
FT                   GSQRWLDGQTVKLEYELPLAEIVFDFYDNLKSASRGYASFDYELLEYRESDLVKLTILI
FT                   DEKPAEPLSTIVHRDSAHEVGRKLAKKLKDVIPRQLYEVPVQASIGSRIVARETIKAQR
FT                   KDVTAKCYGGDVSRKKKLLEEQKEGKKRMKQMGEIDVPQEAFLAILSVDED"
     MQPTGPAAPR PFTGRPSDGL SCLMPDLSTI RNFCIIAHID HGKSTLADRL LERTGTITER        60
     EMKEQTLDDM DLERERGITI KSHAVRMAHT APDGQEYTLN LIDTPGHVDF TYEVSRALKA       120
     CEGAILLVDA AQGIEAQTIS NLWLALEQDL EIIPVINKID LPVARPDEVA QALEDLIGEP       180
     AEDILQISAK TGEGVDEMLD LMIDRVPPPS GDPDAPLRAL IFDSIYDSYR GSVVYARVFD       240
     GTLEAGDTME FMSNKKQYDA EEMGILRMGR QKVDTFTAGD VGYIIGSIKD IQDARVGDTI       300
     TTAHDPAEEP IPGFEEVKPM VFSGIYPTET DDFEELRGAL EKLQLNDASL TYQAESSSAL       360
     GYGFRVGFLG LLHMEIIQER LEREFDLDII TTVPNVEYEV EVEEKGEPKT VTVDKPEDMP       420
     HYGDIEAVHE PYVKADIITP SDYIGNVIEL CEKRRGEYGS QRWLDGQTVK LEYELPLAEI       480
     VFDFYDNLKS ASRGYASFDY ELLEYRESDL VKLTILIDEK PAEPLSTIVH RDSAHEVGRK       540
     LAKKLKDVIP RQLYEVPVQA SIGSRIVARE TIKAQRKDVT AKCYGGDVSR KKKLLEEQKE       600
     GKKRMKQMGE IDVPQEAFLA ILSVDED                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page