(data stored in ACNUC30630 zone)

EMBL: FP565814.LEXA

FP565814.LEXA        Location/Qualifiers
FT   CDS             complement(771219..771971)
FT                   /transl_table=11
FT                   /gene="lexA"
FT                   /locus_tag="SRM_00637"
FT                   /product="LexA repressor"
FT                   /function="# Represses a number of genes involved in the
FT                   response to DNA damage (SOS response), including recA and
FT                   lexA. Binds to the 16 bp palindromic sequence 5'-
FT                   CTGTATATATATACAG-3'. In the presence of single-stranded
FT                   DNA, recA interacts with lexA causing an autocatalytic
FT                   cleavage which disrupts the DNA-binding part of lexA,
FT                   leading to derepression of the SOS regulon and eventually
FT                   DNA repair (By similarity)."
FT                   /EC_number="3.4.21.88"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00637"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23558"
FT                   /db_xref="GOA:D5H6A3"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6A3"
FT                   /protein_id="CBH23558.1"
FT                   /translation="MLLPGWGGRTYVCSPSRQRSRTSPRPPPQPASFSMSKEPLTQRQN
FT                   QAYDFIEQYLDRHRKPPTLQEIGDALDIASTNGVYKLLQKLEEKGWIEREKHKARSIQL
FT                   AGREQDPLGQGGGPPTLPIVSRTPSDHPERLRERPAGTLSVDHQLLRNARTPDDCLLGR
FT                   AGDDGMIETGIQKGDLLLIEEREWDDLDNRTLVAVLLQDQLLAREFEFANRKIHLRPTA
FT                   PHYAEETFSPTESDYYVVGRVLGLIRTL"
     MLLPGWGGRT YVCSPSRQRS RTSPRPPPQP ASFSMSKEPL TQRQNQAYDF IEQYLDRHRK        60
     PPTLQEIGDA LDIASTNGVY KLLQKLEEKG WIEREKHKAR SIQLAGREQD PLGQGGGPPT       120
     LPIVSRTPSD HPERLRERPA GTLSVDHQLL RNARTPDDCL LGRAGDDGMI ETGIQKGDLL       180
     LIEEREWDDL DNRTLVAVLL QDQLLAREFE FANRKIHLRP TAPHYAEETF SPTESDYYVV       240
     GRVLGLIRTL                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page